SCOPe 2.07: Domain d2fz2a_: 2fz2 A:

Lineage for d2fz2a_ (2fz2 A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.6: Tymoviridae-like VP [88641] (2 proteins)
   automatically mapped to Pfam PF00983

6. Protein automated matches [190649] (1 species)
   not a true protein

7. Species Turnip yellow mosaic virus [TaxId:12155] [187728] (2 PDB entries)

8. Domain d2fz2a_: 2fz2 A: [164516]
   automated match to d1auyb_
   protein/RNA complex

Details for d2fz2a_

PDB Entry: 2fz2, 2.9 Å

PDB Description: Structure of Turnip Yellow Mosaic Virus at 100 K

PDB Compounds: (A:) coat protein

SCOPe Domain Sequences for d2fz2a_:

Sequence; same for both SEQRES and ATOM records:

>d2fz2a_ b.121.4.6 (A:) automated matches {Turnip yellow mosaic virus [TaxId: 12155]}
pspftikqpfqsevlfagtkdaeasltianidsvstlttfyrhasleslwvtihptlqap
afpttvgvcwvpaqspvtptqitktyggqifciggaiqtlsplivkcplemmqprvkdsi
qyldspkllisitaqptappastciitvsgtlsmhsplitdtst

Timeline for d2fz2a_:

• d2fz2a_ first appeared in SCOPe 2.01
  
• d2fz2a_ appears in SCOPe 2.06
  
• d2fz2a_ appears in the current release, SCOPe 2.08