SCOP 1.67: Domain d1hiob_: 1hio B:

Lineage for d1hiob_ (1hio B:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (3 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H2B [47119] (3 species)

7. Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47120] (4 PDB entries)

8. Domain d1hiob_: 1hio B: [16449]
   Other proteins in same PDB: d1hioa_, d1hioc_, d1hiod_

Details for d1hiob_

PDB Entry: 1hio, 3.1 Å

PDB Description: histone octamer (chicken), chromosomal protein, alpha carbons only

SCOP Domain Sequences for d1hiob_:

Sequence; same for both SEQRES and ATOM records:

>d1hiob_ a.22.1.1 (B:) Histone H2B {Chicken (Gallus gallus), erythrocytes}
sysiyvykvlkqvhpdtgisskamgsmnsfvndiferiaglasrlahynkrstitsreiq
tavrlllpgelakhavsegtkavtkhtssk

Timeline for d1hiob_:

• d1hiob_ first appeared (with stable ids) in SCOP 1.55
  
• d1hiob_ appears in SCOP 1.65
  
• d1hiob_ appears in SCOP 1.69
  
• d1hiob_ appears in the current release, SCOPe 2.08