Lineage for d1hiob_ (1hio B:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 96049Fold a.22: Histone-fold [47112] (1 superfamily)
  4. 96050Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 96051Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
  6. 96069Protein Histone H2B [47119] (3 species)
  7. 96078Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47120] (4 PDB entries)
  8. 96084Domain d1hiob_: 1hio B: [16449]
    Other proteins in same PDB: d1hioa_, d1hioc_, d1hiod_

Details for d1hiob_

PDB Entry: 1hio (more details), 3.1 Å

PDB Description: histone octamer (chicken), chromosomal protein, alpha carbons only

SCOP Domain Sequences for d1hiob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hiob_ a.22.1.1 (B:) Histone H2B {Chicken (Gallus gallus), erythrocytes}
sysiyvykvlkqvhpdtgisskamgsmnsfvndiferiaglasrlahynkrstitsreiq
tavrlllpgelakhavsegtkavtkhtssk

SCOP Domain Coordinates for d1hiob_:

Click to download the PDB-style file with coordinates for d1hiob_.
(The format of our PDB-style files is described here.)

Timeline for d1hiob_: