SCOPe 2.05: Domain d2hiob_: 2hio B:

Lineage for d2hiob_ (2hio B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H2B [47119] (6 species)

7. Species Chicken (Gallus gallus), erythrocytes [TaxId:9031] [47120] (6 PDB entries)
   Uniprot P02279

8. Domain d2hiob_: 2hio B: [16448]
   Other proteins in same PDB: d2hioa_, d2hioc_, d2hiod_

Details for d2hiob_

PDB Entry: 2hio, 3.1 Å

PDB Description: histone octamer (chicken), chromosomal protein

PDB Compounds: (B:) protein (histone h2b)

SCOPe Domain Sequences for d2hiob_:

Sequence; same for both SEQRES and ATOM records:

>d2hiob_ a.22.1.1 (B:) Histone H2B {Chicken (Gallus gallus), erythrocytes [TaxId: 9031]}
sysiyvykvlkqvhpdtgisskamgimnsfvndiferiageasrlahynkrstitsreiq
tavrlllpgelakhavsegtkavtkytssk

Timeline for d2hiob_:

• d2hiob_ first appeared (with stable ids) in SCOP 1.55
  
• d2hiob_ appears in SCOPe 2.04
  
• d2hiob_ appears in SCOPe 2.06
  
• d2hiob_ appears in the current release, SCOPe 2.08