SCOPe 2.06: Domain d2fv9b_: 2fv9 B:

Lineage for d2fv9b_ (2fv9 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.10: TNF-alpha converting enzyme, TACE, catalytic domain [55525] (2 proteins)
   automatically mapped to Pfam PF13574
   automatically mapped to Pfam PF13583

6. Protein TNF-alpha converting enzyme, TACE, catalytic domain [55526] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [55527] (20 PDB entries)

8. Domain d2fv9b_: 2fv9 B: [164475]
   automated match to d1bkca_
   complexed with 002, inn, zn

Details for d2fv9b_

PDB Entry: 2fv9, 2.02 Å

PDB Description: crystal structure of tace in complex with jmv 390-1

PDB Compounds: (B:) adam 17

SCOPe Domain Sequences for d2fv9b_:

Sequence; same for both SEQRES and ATOM records:

>d2fv9b_ d.92.1.10 (B:) TNF-alpha converting enzyme, TACE, catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
pmkntckllvvadhrfyrymgrgeestttnylielidrvddiyrntawdnagfkgygiqi
eqirilkspqevkpgekhynmaksypneekdawdvkmlleqfsfdiaeeaskvclahlft
yqdfdmgtlglayggspranshggvcpkayyspvgkkniylnsgltstknygktiltkea
dlvtthelghnfgaehdpdglaecapnedqggkyvmypiavsgdhennkmfsqcskqsiy
ktieskaqecfqer

Timeline for d2fv9b_:

• d2fv9b_ first appeared in SCOPe 2.01
  
• d2fv9b_ appears in SCOPe 2.05
  
• d2fv9b_ appears in SCOPe 2.07
  
• d2fv9b_ appears in the current release, SCOPe 2.08