SCOP 1.63: Domain d1aoic_: 1aoi C:

Lineage for d1aoic_ (1aoi C:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (3 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H2A [47115] (4 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47117] (7 PDB entries)

8. Domain d1aoic_: 1aoi C: [16440]
   Other proteins in same PDB: d1aoia_, d1aoib_, d1aoid_, d1aoie_, d1aoif_, d1aoih_

Details for d1aoic_

PDB Entry: 1aoi, 2.8 Å

PDB Description: complex between nucleosome core particle (h3,h4,h2a,h2b) and 146 bp long dna fragment

SCOP Domain Sequences for d1aoic_:

Sequence; same for both SEQRES and ATOM records:

>d1aoic_ a.22.1.1 (C:) Histone H2A {African clawed frog (Xenopus laevis)}
gkqggktrakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeil
elagnaardnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpk

Timeline for d1aoic_:

• d1aoic_ first appeared (with stable ids) in SCOP 1.55
  
• d1aoic_ appears in SCOP 1.61
  
• d1aoic_ appears in SCOP 1.65
  
• d1aoic_ appears in the current release, SCOPe 2.08