Lineage for d2fhhp_ (2fhh P:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1676433Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1676434Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1676603Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1678261Protein automated matches [190144] (7 species)
    not a true protein
  7. 1678706Species Mycobacterium tuberculosis [TaxId:1773] [187707] (9 PDB entries)
  8. 1678920Domain d2fhhp_: 2fhh P: [164378]
    automated match to d1q5qh_
    complexed with m1n

Details for d2fhhp_

PDB Entry: 2fhh (more details), 2.99 Å

PDB Description: Crystal Structure of Mycobacterium Tuberculosis Proteasome in complex with a peptidyl boronate inhibitor MLN-273
PDB Compounds: (P:) proteasome, beta subunit

SCOPe Domain Sequences for d2fhhp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fhhp_ d.153.1.4 (P:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
ttivalkypggvvmagdrrstqgnmisgrdvrkvyitddytatgiagtaavavefarlya
velehyeklegvpltfagkinrlaimvrgnlaaamqgllalpllagydihasdpqsagri
vsfdaaggwnieeegyqavgsgslfakssmkklysqvtdgdsglrvavealydaadddsa
tggpdlvrgifptaviidadgavdvpesriaelaraiiesrs

SCOPe Domain Coordinates for d2fhhp_:

Click to download the PDB-style file with coordinates for d2fhhp_.
(The format of our PDB-style files is described here.)

Timeline for d2fhhp_: