Lineage for d2fa9a_ (2fa9 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1362829Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1363774Protein automated matches [190047] (16 species)
    not a true protein
  7. 1363785Species Chinese hamster (Cricetulus griseus) [TaxId:10029] [187100] (2 PDB entries)
  8. 1363788Domain d2fa9a_: 2fa9 A: [164309]
    automated match to d1f6ba_
    complexed with gdp, mg, so4

Details for d2fa9a_

PDB Entry: 2fa9 (more details), 2.5 Å

PDB Description: the crystal structure of sar1[h79g]-gdp provides insight into the coat-controlled gtp hydrolysis in the disassembly of cop ii
PDB Compounds: (A:) GTP-binding protein SAR1b

SCOPe Domain Sequences for d2fa9a_:

Sequence, based on SEQRES records: (download)

>d2fa9a_ c.37.1.8 (A:) automated matches {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
ssvlqflglykktgklvflgldnagkttllhmlkddrlgqhvptlhptseeltiagmtft
tfdlgggiqarrvwknylpaingivflvdcadherlleskeeldslmtdetianvpilil
gnkidrpeaiseerlremfglygqttgkgsvslkelnarplevfmcsvlkrqgygegfrw
maqyid

Sequence, based on observed residues (ATOM records): (download)

>d2fa9a_ c.37.1.8 (A:) automated matches {Chinese hamster (Cricetulus griseus) [TaxId: 10029]}
ssvlqflglykktgklvflgldnagkttllhmlkptseeltiagmtfttfdlgrrvwkny
lpaingivflvdcadherlleskeeldslmtdetianvpililgnkidrpeaiseerlre
mfglygqttgkgsvslkelnarplevfmcsvlkrqgygegfrwmaqyid

SCOPe Domain Coordinates for d2fa9a_:

Click to download the PDB-style file with coordinates for d2fa9a_.
(The format of our PDB-style files is described here.)

Timeline for d2fa9a_: