SCOPe 2.02: Domain d2f94f_: 2f94 F:

Lineage for d2f94f_ (2f94 F:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.128: Terpenoid synthases [48575] (1 superfamily)
   multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers

4. Superfamily a.128.1: Terpenoid synthases [48576] (6 families)
   duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J

5. Family a.128.1.1: Isoprenyl diphosphate synthases [48577] (4 proteins)

6. Protein automated matches [190489] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187688] (21 PDB entries)

8. Domain d2f94f_: 2f94 F: [164288]
   automated match to d1fpsa_
   complexed with bfq, po4, zn

Details for d2f94f_

PDB Entry: 2f94, 1.94 Å

PDB Description: crystal structure of human fpps in complex with ibandronate

PDB Compounds: (F:) Farnesyl Diphosphate Synthase

SCOPe Domain Sequences for d2f94f_:

Sequence; same for both SEQRES and ATOM records:

>d2f94f_ a.128.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvyaqekqdfvqhfsqivrvltedemghpeigdaiarlkevleynaiggkynrgltvvva
frelveprkqdadslqrawtvgwcvellqafflvaddimdssltrrgqicwyqkpgvgld
aindanlleaciyrllklycreqpyylnlielflqssyqteigqtldlltapqgnvdlvr
ftekryksivkyktafysfylpiaaamymagidgekehanakkillemgeffqiqddyld
lfgdpsvtgkigtdiqdnkcswlvvqclqratpeqyqilkenygqkeaekvarvkalyee
ldlpavflqyeedsyshimalieqyaaplppavflglarkiy

Timeline for d2f94f_:

• d2f94f_ first appeared in SCOPe 2.01
  
• d2f94f_ appears in SCOPe 2.03
  
• d2f94f_ appears in the current release, SCOPe 2.08