SCOPe 2.02: Domain d2exsa_: 2exs A:

Lineage for d2exsa_ (2exs A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.5: TRAP-like [51219] (2 families)
   shorter variant of double-helix; assembles in large ring-like structures containing from 9 to 11 domains

5. Family b.82.5.1: Trp RNA-binding attenuation protein (TRAP) [51220] (2 proteins)
   oligomeric ring consists of 11 single-domain subunits

6. Protein Trp RNA-binding attenuation protein (TRAP) [51221] (2 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [51223] (11 PDB entries)

8. Domain d2exsa_: 2exs A: [164207]
   automated match to d1c9sm_
   complexed with trp

Details for d2exsa_

PDB Entry: 2exs, 2 Å

PDB Description: TRAP3 (engineered TRAP)

PDB Compounds: (A:) transcription attenuation protein mtrb

SCOPe Domain Sequences for d2exsa_:

Sequence; same for both SEQRES and ATOM records:

>d2exsa_ b.82.5.1 (A:) Trp RNA-binding attenuation protein (TRAP) {Bacillus stearothermophilus [TaxId: 1422]}
sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtm
hgv

Timeline for d2exsa_:

• d2exsa_ first appeared in SCOPe 2.01
  
• d2exsa_ appears in SCOPe 2.03
  
• d2exsa_ appears in the current release, SCOPe 2.08