Lineage for d2eoab_ (2eoa B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the restSuperfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) 
Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins) 
Protein automated matches [190196] (7 species)
not a true protein
Species Thermus thermophilus [TaxId:274] [187977] (7 PDB entries) 
Domain d2eoab_: 2eoa B: [164186]
automated match to d1v37a_
Details for d2eoab_
PDB Entry: 2eoa (more details), 1.75 Å
PDB Description: structural study of project id tthb049 from thermus thermophilus hb8 (w85h)
PDB Compounds: (B:) Alpha-ribazole-5'-phosphate phosphataseSCOPe Domain Sequences for d2eoab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eoab_ c.60.1.1 (B:) automated matches {Thermus thermophilus [TaxId: 274]}
melwlvrhgetlwnregrllgwtdlpltaegeaqarrlkgalpslpafssdllrarrtae
lagfsprlypelreihfgalegalhetldprykeallrfqgfhppggeslsafqervfrf
leglkapavlfthggvvravlralgedglvppgsavavdwprrvlvrlal
SCOPe Domain Coordinates for d2eoab_:
Click to download the PDB-style file with coordinates for d2eoab_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2eoab_:
- d2eoab_ first appeared in SCOPe 2.01
- d2eoab_ appears in SCOPe 2.07
View in 3D
