Lineage for d2eoaa_ (2eoa A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2498790Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 2498791Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 2498792Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins)
  6. 2498844Protein automated matches [190196] (7 species)
    not a true protein
  7. 2498949Species Thermus thermophilus [TaxId:274] [187977] (7 PDB entries)
  8. 2498955Domain d2eoaa_: 2eoa A: [164185]
    automated match to d1v37a_

Details for d2eoaa_

PDB Entry: 2eoa (more details), 1.75 Å

PDB Description: structural study of project id tthb049 from thermus thermophilus hb8 (w85h)
PDB Compounds: (A:) Alpha-ribazole-5'-phosphate phosphatase

SCOPe Domain Sequences for d2eoaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eoaa_ c.60.1.1 (A:) automated matches {Thermus thermophilus [TaxId: 274]}
melwlvrhgetlwnregrllgwtdlpltaegeaqarrlkgalpslpafssdllrarrtae
lagfsprlypelreihfgalegalhetldprykeallrfqgfhppggeslsafqervfrf
leglkapavlfthggvvravlralgedglvppgsavavdwprrvlvrlald

SCOPe Domain Coordinates for d2eoaa_:

Click to download the PDB-style file with coordinates for d2eoaa_.
(The format of our PDB-style files is described here.)

Timeline for d2eoaa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2eoab_