Lineage for d2eo8d_ (2eo8 D:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1173024Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 1173786Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (2 families) (S)
  5. 1173787Family c.56.4.1: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53183] (2 proteins)
  6. 1173788Protein Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53184] (4 species)
  7. 1173802Species Pyrococcus furiosus [TaxId:2261] [64099] (7 PDB entries)
  8. 1173822Domain d2eo8d_: 2eo8 D: [164184]
    automated match to d1ioia_
    mutant

Details for d2eo8d_

PDB Entry: 2eo8 (more details), 2.3 Å

PDB Description: crystal structure of a mutant pyrrolidone carboxyl peptidase (a199p) from p. furiosus
PDB Compounds: (D:) Pyrrolidone-carboxylate peptidase

SCOPe Domain Sequences for d2eo8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eo8d_ c.56.4.1 (D:) Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) {Pyrococcus furiosus [TaxId: 2261]}
mkvlvtgfepfggekinpteriakdldgikigdaqvfgrvlpvvfgkakevlektleeik
pdiaihvglapgrsaisieriavnaidaripdnegkkiedepivpgaptayfstlpikki
mkklhergipayisnsaglylsnyvmylslhhsatkgypkmsgfihvpyipeqiidkigk
gqvppsmsyemeleavkvpievaleell

SCOPe Domain Coordinates for d2eo8d_:

Click to download the PDB-style file with coordinates for d2eo8d_.
(The format of our PDB-style files is described here.)

Timeline for d2eo8d_: