SCOPe 2.04: Domain d2eirb_: 2eir B:

Lineage for d2eirb_ (2eir B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein automated matches [190442] (12 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187670] (1 PDB entry)

8. Domain d2eirb_: 2eir B: [164054]
   automated match to d1xoaa_
   complexed with cu

Details for d2eirb_

PDB Entry: 2eir, 2.5 Å

PDB Description: design of disulfide-linked thioredoxin dimers and multimers through analysis of crystal contacts

PDB Compounds: (B:) Thioredoxin 1

SCOPe Domain Sequences for d2eirb_:

Sequence; same for both SEQRES and ATOM records:

>d2eirb_ c.47.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
dqnpgtapkygirgiptlllfkngevaatkvgalskgqlkcfldcnl

Timeline for d2eirb_:

• d2eirb_ first appeared in SCOPe 2.01
  
• d2eirb_ appears in SCOPe 2.03
  
• d2eirb_ appears in SCOPe 2.05
  
• d2eirb_ appears in the current release, SCOPe 2.08