SCOPe 2.07: Domain d2eiqa_: 2eiq A:

Lineage for d2eiqa_ (2eiq A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein Thioredoxin [52835] (16 species)

7. Species Escherichia coli [TaxId:562] [52836] (55 PDB entries)
   Uniprot P00274 ! Uniprot P00581

8. Domain d2eiqa_: 2eiq A: [164051]
   automated match to d1xoaa_
   complexed with cu, mpd

Details for d2eiqa_

PDB Entry: 2eiq, 1.9 Å

PDB Description: design of disulfide-linked thioredoxin dimers and multimers through analysis of crystal contacts

PDB Compounds: (A:) Thioredoxin 1

SCOPe Domain Sequences for d2eiqa_:

Sequence; same for both SEQRES and ATOM records:

>d2eiqa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]}
sdkiihltddsfdtdvlkadgailvdfwaewcgpckmiapildeiadeyqgkltvaklni
dqnpgtapkygirgiptlllfkngevaackvgalskgqlkefldanl

Timeline for d2eiqa_:

• d2eiqa_ first appeared in SCOPe 2.01
  
• d2eiqa_ appears in SCOPe 2.06
  
• d2eiqa_ appears in the current release, SCOPe 2.08