Lineage for d1enia_ (1eni A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697866Fold a.18: T4 endonuclease V [47076] (1 superfamily)
    3 helices; irregular array
  4. 2697867Superfamily a.18.1: T4 endonuclease V [47077] (1 family) (S)
    automatically mapped to Pfam PF03013
  5. 2697868Family a.18.1.1: T4 endonuclease V [47078] (1 protein)
  6. 2697869Protein T4 endonuclease V [47079] (1 species)
  7. 2697870Species Bacteriophage T4 [TaxId:10665] [47080] (6 PDB entries)
  8. 2697874Domain d1enia_: 1eni A: [16403]
    mutant

Details for d1enia_

PDB Entry: 1eni (more details), 2.2 Å

PDB Description: crystal structure of a pyrimidine dimer specific excision repair enzyme from bacteriophage t4: refinement at 1.45 angstroms and x-ray analysis of the three active site mutants
PDB Compounds: (A:) endonuclease v

SCOPe Domain Sequences for d1enia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1enia_ a.18.1.1 (A:) T4 endonuclease V {Bacteriophage T4 [TaxId: 10665]}
tqinltlvseladqhlmaeyrelprvfgavrkhvangkrvrdfkisptfilgaghvtffy
dkleflrkrqieliaeclkrgfnikdttvqdisdipqefrgdyipheasiaisqarldek
iaqrptwykyygkaiya

SCOPe Domain Coordinates for d1enia_:

Click to download the PDB-style file with coordinates for d1enia_.
(The format of our PDB-style files is described here.)

Timeline for d1enia_: