Lineage for d2egka_ (2egk A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 948106Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 948107Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 948564Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 948565Protein automated matches [190436] (3 species)
    not a true protein
  7. 948602Species Norway rat (Rattus norvegicus) [TaxId:10116] [187666] (3 PDB entries)
  8. 948605Domain d2egka_: 2egk A: [164009]
    automated match to d1gq5a_
    complexed with po4

Details for d2egka_

PDB Entry: 2egk (more details), 2.85 Å

PDB Description: crystal structure of tamalin pdz-intrinsic ligand fusion protein
PDB Compounds: (A:) General receptor for phosphoinositides 1-associated scaffold protein

SCOPe Domain Sequences for d2egka_:

Sequence, based on SEQRES records: (download)

>d2egka_ b.36.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qrkvltlekgdnqtfgfeiqtyglhhreeqrvemvtfvarvhesspaqlagltpgdtias
vnglnvegirhreivdiikasgnvlrletlygteesql

Sequence, based on observed residues (ATOM records): (download)

>d2egka_ b.36.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
qrkvltlekgdnqtfgfeiqtyglmvtfvarvhesspaqlagltpgdtiasvnglnvegi
rhreivdiikasgnvlrletlygteesql

SCOPe Domain Coordinates for d2egka_:

Click to download the PDB-style file with coordinates for d2egka_.
(The format of our PDB-style files is described here.)

Timeline for d2egka_: