SCOPe 2.08: Domain d2egjb_: 2egj B:

Lineage for d2egjb_ (2egj B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families)

5. Family d.38.1.0: automated matches [191325] (1 protein)
   not a true family

6. Protein automated matches [190143] (42 species)
   not a true protein

7. Species Aquifex aeolicus [TaxId:63363] [187664] (3 PDB entries)

8. Domain d2egjb_: 2egj B: [164008]
   automated match to d1z54a1

Details for d2egjb_

PDB Entry: 2egj, 1.8 Å

PDB Description: crystal structure of hypothetical protein(aq1494) from aquifex aeolicus

PDB Compounds: (B:) Hypothetical protein aq_1494

SCOPe Domain Sequences for d2egjb_:

Sequence; same for both SEQRES and ATOM records:

>d2egjb_ d.38.1.0 (B:) automated matches {Aquifex aeolicus [TaxId: 63363]}
pfiyrrrvqfyetdaqgivhhsnyfryfeeargeflrskgfpyskmrdmglevvllnayc
eykkplfyddvfevhlnleelsrftftfsyivfkediavakantkhcmvkngkivsipke
vlevlk

Timeline for d2egjb_:

• d2egjb_ first appeared in SCOPe 2.01
  
• d2egjb_ appears in SCOPe 2.07