Lineage for d2egjb_ (2egj B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2944312Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2944313Protein automated matches [190143] (42 species)
    not a true protein
  7. 2944327Species Aquifex aeolicus [TaxId:63363] [187664] (3 PDB entries)
  8. 2944331Domain d2egjb_: 2egj B: [164008]
    automated match to d1z54a1

Details for d2egjb_

PDB Entry: 2egj (more details), 1.8 Å

PDB Description: crystal structure of hypothetical protein(aq1494) from aquifex aeolicus
PDB Compounds: (B:) Hypothetical protein aq_1494

SCOPe Domain Sequences for d2egjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2egjb_ d.38.1.0 (B:) automated matches {Aquifex aeolicus [TaxId: 63363]}
pfiyrrrvqfyetdaqgivhhsnyfryfeeargeflrskgfpyskmrdmglevvllnayc
eykkplfyddvfevhlnleelsrftftfsyivfkediavakantkhcmvkngkivsipke
vlevlk

SCOPe Domain Coordinates for d2egjb_:

Click to download the PDB-style file with coordinates for d2egjb_.
(The format of our PDB-style files is described here.)

Timeline for d2egjb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2egja_