Lineage for d2egih_ (2egi H:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2550604Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2550605Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2551373Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2551374Protein automated matches [190143] (41 species)
    not a true protein
  7. 2551388Species Aquifex aeolicus [TaxId:63363] [187664] (3 PDB entries)
  8. 2551399Domain d2egih_: 2egi H: [164005]
    automated match to d1z54a1
    complexed with gol

Details for d2egih_

PDB Entry: 2egi (more details), 2.3 Å

PDB Description: crystal structure of a hypothetical protein(aq1494) from aquifex aeolicus
PDB Compounds: (H:) Hypothetical protein aq_1494

SCOPe Domain Sequences for d2egih_:

Sequence, based on SEQRES records: (download)

>d2egih_ d.38.1.0 (H:) automated matches {Aquifex aeolicus [TaxId: 63363]}
fiyrrrvqfyetdaqgivhhsnyfryfeeargeflrskgfpyskmrdmglevvllnayce
ykkplfyddvfevhlnleelsrftftfsyivfkediavakantkhcmvk

Sequence, based on observed residues (ATOM records): (download)

>d2egih_ d.38.1.0 (H:) automated matches {Aquifex aeolicus [TaxId: 63363]}
fiyrrrvqfyetdaqgivhhsnyfryfeeargeflrskevvllnayceykkplfyddvfe
vhlnleelsrftftfsyivfkediavakantkhcmvk

SCOPe Domain Coordinates for d2egih_:

Click to download the PDB-style file with coordinates for d2egih_.
(The format of our PDB-style files is described here.)

Timeline for d2egih_: