Lineage for d2efhb_ (2efh B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2124192Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2125254Protein automated matches [190047] (29 species)
    not a true protein
  7. 2125762Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [188355] (9 PDB entries)
  8. 2125766Domain d2efhb_: 2efh B: [163983]
    automated match to d1r2qa_
    complexed with gdp

Details for d2efhb_

PDB Entry: 2efh (more details), 2.1 Å

PDB Description: ara7-gdp/atvps9a(d185n)
PDB Compounds: (B:) Small GTP-binding protein-like

SCOPe Domain Sequences for d2efhb_:

Sequence, based on SEQRES records: (download)

>d2efhb_ c.37.1.8 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sinaklvllgdvgagksslvlrfvkdqfvefqestigaaffsqtlavndatvkfeiwdta
gqeryhslapmyyrgaaaaiivfdvtnqasferakkwvqelqaqgnpnmvmalagnksdl
ldarkvtaedaqtyaqenglffmetsaktatnvkeifyeiarrlp

Sequence, based on observed residues (ATOM records): (download)

>d2efhb_ c.37.1.8 (B:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sinaklvllgdvgagksslvlrfvaaffsqtlavndatvkfeiwdtagqeryhslapmyy
rgaaaaiivfdvtnqasferakkwvqelqaqgnpnmvmalagnksdlldarkvtaedaqt
yaqenglffmetsaktatnvkeifyeiarrlp

SCOPe Domain Coordinates for d2efhb_:

Click to download the PDB-style file with coordinates for d2efhb_.
(The format of our PDB-style files is described here.)

Timeline for d2efhb_: