Lineage for d2ec2c_ (2ec2 C:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1030373Superfamily d.58.57: Transposase IS200-like [143422] (1 family) (S)
    contains extra N-terminal hairpin and C-terminal helix, both are involved in dimerization; there can be helix-swapping in the dimer
  5. 1030374Family d.58.57.1: Transposase IS200-like [143423] (4 proteins)
    Pfam PF01797
  6. 1030398Protein automated matches [190624] (2 species)
    not a true protein
  7. 1030403Species Sulfolobus tokodaii [TaxId:111955] [187659] (1 PDB entry)
  8. 1030406Domain d2ec2c_: 2ec2 C: [163950]
    automated match to d2f4fa1
    complexed with so4

Details for d2ec2c_

PDB Entry: 2ec2 (more details), 2.8 Å

PDB Description: Crystal structure of transposase from Sulfolobus tokodaii
PDB Compounds: (C:) 136aa long hypothetical transposase

SCOPe Domain Sequences for d2ec2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ec2c_ d.58.57.1 (C:) automated matches {Sulfolobus tokodaii [TaxId: 111955]}
meykstrhakylcnyhfvwipkyrrkvltgevaeytkevlrtiaeelgcevlalevmpdh
ihlfvncppryapsylanyfkgksarlilkkfqelkkstngklwtrsyfvstsgnvsset
ikkyieeqwa

SCOPe Domain Coordinates for d2ec2c_:

Click to download the PDB-style file with coordinates for d2ec2c_.
(The format of our PDB-style files is described here.)

Timeline for d2ec2c_: