Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.57: Transposase IS200-like [143422] (1 family) contains extra N-terminal hairpin and C-terminal helix, both are involved in dimerization; there can be helix-swapping in the dimer |
Family d.58.57.1: Transposase IS200-like [143423] (4 proteins) Pfam PF01797 |
Protein automated matches [190624] (2 species) not a true protein |
Species Sulfolobus tokodaii [TaxId:111955] [187659] (1 PDB entry) |
Domain d2ec2c_: 2ec2 C: [163950] automated match to d2f4fa1 complexed with so4 |
PDB Entry: 2ec2 (more details), 2.8 Å
SCOPe Domain Sequences for d2ec2c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ec2c_ d.58.57.1 (C:) automated matches {Sulfolobus tokodaii [TaxId: 111955]} meykstrhakylcnyhfvwipkyrrkvltgevaeytkevlrtiaeelgcevlalevmpdh ihlfvncppryapsylanyfkgksarlilkkfqelkkstngklwtrsyfvstsgnvsset ikkyieeqwa
Timeline for d2ec2c_: