Lineage for d2ec2a_ (2ec2 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2198871Superfamily d.58.57: Transposase IS200-like [143422] (1 family) (S)
    contains extra N-terminal hairpin and C-terminal helix, both are involved in dimerization; there can be helix-swapping in the dimer
    automatically mapped to Pfam PF01797
  5. 2198872Family d.58.57.1: Transposase IS200-like [143423] (4 proteins)
    Pfam PF01797
  6. 2198896Protein automated matches [190624] (2 species)
    not a true protein
  7. 2198901Species Sulfolobus tokodaii [TaxId:111955] [187659] (1 PDB entry)
  8. 2198902Domain d2ec2a_: 2ec2 A: [163948]
    automated match to d2f4fa1
    complexed with so4

Details for d2ec2a_

PDB Entry: 2ec2 (more details), 2.8 Å

PDB Description: Crystal structure of transposase from Sulfolobus tokodaii
PDB Compounds: (A:) 136aa long hypothetical transposase

SCOPe Domain Sequences for d2ec2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ec2a_ d.58.57.1 (A:) automated matches {Sulfolobus tokodaii [TaxId: 111955]}
meykstrhakylcnyhfvwipkyrrkvltgevaeytkevlrtiaeelgcevlalevmpdh
ihlfvncppryapsylanyfkgksarlilkkfqelkkstngklwtrsyfvstsgnvsset
ikkyieeqwa

SCOPe Domain Coordinates for d2ec2a_:

Click to download the PDB-style file with coordinates for d2ec2a_.
(The format of our PDB-style files is described here.)

Timeline for d2ec2a_: