Lineage for d2ebja_ (2ebj A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 996821Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 997543Superfamily c.56.4: Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) [53182] (2 families) (S)
  5. 997606Family c.56.4.0: automated matches [191433] (1 protein)
    not a true family
  6. 997607Protein automated matches [190623] (2 species)
    not a true protein
  7. 997611Species Thermus thermophilus [TaxId:300852] [187658] (1 PDB entry)
  8. 997612Domain d2ebja_: 2ebj A: [163946]
    automated match to d1iofa_

Details for d2ebja_

PDB Entry: 2ebj (more details), 1.9 Å

PDB Description: Crystal structure of pyrrolidone carboxyl peptidase from Thermus thermophilus
PDB Compounds: (A:) pyrrolidone carboxyl peptidase

SCOPe Domain Sequences for d2ebja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ebja_ c.56.4.0 (A:) automated matches {Thermus thermophilus [TaxId: 300852]}
milvtgfepfgslehnpsqalldllpsevdgkplrkavlpvdaealgealedlhregpka
vlhlglaedrpvltlerlavnlldfprpdnrgrvledlpivpggplalparfpvkpvlar
wreagipgrpslsagsylcnqafylslyrlpeevpvgflhlppdetlalkrprpyvplev
qaravrlalehl

SCOPe Domain Coordinates for d2ebja_:

Click to download the PDB-style file with coordinates for d2ebja_.
(The format of our PDB-style files is described here.)

Timeline for d2ebja_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ebjb_