Lineage for d2eb6e_ (2eb6 E:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1049483Fold d.177: FAH [56528] (1 superfamily)
    unusual fold; contains 3 layers of beta-sheet structure
  4. 1049484Superfamily d.177.1: FAH [56529] (2 families) (S)
  5. 1049568Family d.177.1.0: automated matches [191367] (1 protein)
    not a true family
  6. 1049569Protein automated matches [190444] (1 species)
    not a true protein
  7. 1049570Species Escherichia coli [TaxId:562] [187351] (3 PDB entries)
  8. 1049580Domain d2eb6e_: 2eb6 E: [163945]
    automated match to d1sv6a_
    complexed with mg

Details for d2eb6e_

PDB Entry: 2eb6 (more details), 1.69 Å

PDB Description: Crystal structure of HpcG complexed with Mg ion
PDB Compounds: (E:) 2-oxo-hept-3-ene-1,7-dioate hydratase

SCOPe Domain Sequences for d2eb6e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eb6e_ d.177.1.0 (E:) automated matches {Escherichia coli [TaxId: 562]}
mfdkhthtliaqrldqaekqreqiraisldypeitiedayavqrewvrlkiaegrtlkgh
kigltskamqassqisepdygallddmffhdgsdiptdrfivprievelafvlakplrgp
nctlfdvynatdyvipalelidarchnidpetqrprkvfdtisdnaanagvilggrpikp
deldlrwisalmyrngvieetgvaagvlnhpangvawlanklapydvqleagqiilggsf
trpvparkgdtfhvdygnmgsiscrfv

SCOPe Domain Coordinates for d2eb6e_:

Click to download the PDB-style file with coordinates for d2eb6e_.
(The format of our PDB-style files is described here.)

Timeline for d2eb6e_: