![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.177: FAH [56528] (1 superfamily) unusual fold; contains 3 layers of beta-sheet structure |
![]() | Superfamily d.177.1: FAH [56529] (2 families) ![]() |
![]() | Family d.177.1.0: automated matches [191367] (1 protein) not a true family |
![]() | Protein automated matches [190444] (1 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [187351] (3 PDB entries) |
![]() | Domain d2eb6e_: 2eb6 E: [163945] automated match to d1sv6a_ complexed with mg |
PDB Entry: 2eb6 (more details), 1.69 Å
SCOPe Domain Sequences for d2eb6e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eb6e_ d.177.1.0 (E:) automated matches {Escherichia coli [TaxId: 562]} mfdkhthtliaqrldqaekqreqiraisldypeitiedayavqrewvrlkiaegrtlkgh kigltskamqassqisepdygallddmffhdgsdiptdrfivprievelafvlakplrgp nctlfdvynatdyvipalelidarchnidpetqrprkvfdtisdnaanagvilggrpikp deldlrwisalmyrngvieetgvaagvlnhpangvawlanklapydvqleagqiilggsf trpvparkgdtfhvdygnmgsiscrfv
Timeline for d2eb6e_:
![]() Domains from other chains: (mouse over for more information) d2eb6a_, d2eb6b_, d2eb6c_, d2eb6d_ |