Lineage for d2e7ab_ (2e7a B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777171Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777172Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2777173Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 2777555Protein automated matches [190204] (3 species)
    not a true protein
  7. 2777556Species Human (Homo sapiens) [TaxId:9606] [186956] (13 PDB entries)
  8. 2777563Domain d2e7ab_: 2e7a B: [163889]
    automated match to d1a8ma_
    mutant

Details for d2e7ab_

PDB Entry: 2e7a (more details), 1.8 Å

PDB Description: tnf receptor subtype one-selective tnf mutant with antagonistic activity
PDB Compounds: (B:) Tumor necrosis factor

SCOPe Domain Sequences for d2e7ab_:

Sequence, based on SEQRES records: (download)

>d2e7ab_ b.22.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
psdmpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfsgq
gcpsthvllthtisristthnqpvnllsairspcqretpegaeanpwyepiylggvfqle
pgdrlsaeinrpdyldfaesgqvyfgiial

Sequence, based on observed residues (ATOM records): (download)

>d2e7ab_ b.22.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
psdmpvahvvanpqaegqlqwlnrranallangvelrdnqlvvpseglyliysqvlfsgq
gcpsthvllthtisristthnqpvnllsairspcqanpwyepiylggvfqlepgdrlsae
inrpdyldfaesgqvyfgiial

SCOPe Domain Coordinates for d2e7ab_:

Click to download the PDB-style file with coordinates for d2e7ab_.
(The format of our PDB-style files is described here.)

Timeline for d2e7ab_: