SCOPe 2.04: Domain d2e66c_: 2e66 C:

Lineage for d2e66c_ (2e66 C:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins)

6. Protein Cut A1 [89931] (5 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [102974] (6 PDB entries)
   Uniprot O58720

8. Domain d2e66c_: 2e66 C: [163843]
   automated match to d1ukua_
   complexed with cl, na; mutant

Details for d2e66c_

PDB Entry: 2e66, 2 Å

PDB Description: crystal structure of cuta1 from pyrococcus horikoshii ot3, mutation d60a

PDB Compounds: (C:) Divalent-cation tolerance protein cutA

SCOPe Domain Sequences for d2e66c_:

Sequence; same for both SEQRES and ATOM records:

>d2e66c_ d.58.5.2 (C:) Cut A1 {Pyrococcus horikoshii [TaxId: 53953]}
miivyttfpdwesaekvvktllkerliacanlrehrafywwegkieedkevgailktrea
lweelkerikelhpydvpaiiridvddvnedylkwlieetkk

Timeline for d2e66c_:

• d2e66c_ first appeared in SCOPe 2.01
  
• d2e66c_ appears in SCOPe 2.03
  
• d2e66c_ appears in SCOPe 2.05
  
• d2e66c_ appears in the current release, SCOPe 2.08