Lineage for d2e55b_ (2e55 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2499119Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2499120Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2499680Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2499681Protein automated matches [190891] (38 species)
    not a true protein
  7. 2499698Species Aquifex aeolicus [TaxId:63363] [188297] (1 PDB entry)
  8. 2499700Domain d2e55b_: 2e55 B: [163831]
    automated match to d1o5oa_
    complexed with so4

Details for d2e55b_

PDB Entry: 2e55 (more details), 2.15 Å

PDB Description: Structure of AQ2163 protein from Aquifex aeolicus
PDB Compounds: (B:) uracil phosphoribosyltransferase

SCOPe Domain Sequences for d2e55b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e55b_ c.61.1.0 (B:) automated matches {Aquifex aeolicus [TaxId: 63363]}
mivelshplikhkvntariqdtsaeklrktlkelgfmlvyealkdilleekevrtwignk
rfnylneeeivfvpilraglsflegalqvvpnakvgflgikrneetleshiyysrlpelk
gkivvildpmlatggtlevalreilkhsplkvksvhaiaapeglkrieekfkeveifvgn
vderlndkgyiipglgdigdrlyavsvy

SCOPe Domain Coordinates for d2e55b_:

Click to download the PDB-style file with coordinates for d2e55b_.
(The format of our PDB-style files is described here.)

Timeline for d2e55b_: