SCOPe 2.02: Domain d2e55b_: 2e55 B:

Lineage for d2e55b_ (2e55 B:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (5 species)
   not a true protein

7. Species Aquifex aeolicus [TaxId:63363] [188297] (1 PDB entry)

8. Domain d2e55b_: 2e55 B: [163831]
   automated match to d1o5oa_
   complexed with so4

Details for d2e55b_

PDB Entry: 2e55, 2.15 Å

PDB Description: Structure of AQ2163 protein from Aquifex aeolicus

PDB Compounds: (B:) uracil phosphoribosyltransferase

SCOPe Domain Sequences for d2e55b_:

Sequence; same for both SEQRES and ATOM records:

>d2e55b_ c.61.1.0 (B:) automated matches {Aquifex aeolicus [TaxId: 63363]}
mivelshplikhkvntariqdtsaeklrktlkelgfmlvyealkdilleekevrtwignk
rfnylneeeivfvpilraglsflegalqvvpnakvgflgikrneetleshiyysrlpelk
gkivvildpmlatggtlevalreilkhsplkvksvhaiaapeglkrieekfkeveifvgn
vderlndkgyiipglgdigdrlyavsvy

Timeline for d2e55b_:

• d2e55b_ first appeared in SCOPe 2.01
  
• d2e55b_ appears in SCOPe 2.03
  
• d2e55b_ appears in the current release, SCOPe 2.08