SCOPe 2.08: Domain d1ns1b_: 1ns1 B:

Lineage for d1ns1b_ (1ns1 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families)

5. Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins)

6. Protein N-terminal, RNA-binding domain of nonstructural protein NS1 [47062] (4 species)

7. Species Influenza A virus, different strains [TaxId:11320] [47063] (2 PDB entries)

8. Domain d1ns1b_: 1ns1 B: [16383]

Details for d1ns1b_

PDB Entry: 1ns1

PDB Description: rna-binding domain of non-structural protein 1 from influenza virus, nmr, 16 structures

PDB Compounds: (B:) nonstructural protein 1

SCOPe Domain Sequences for d1ns1b_:

Sequence; same for both SEQRES and ATOM records:

>d1ns1b_ a.16.1.1 (B:) N-terminal, RNA-binding domain of nonstructural protein NS1 {Influenza A virus, different strains [TaxId: 11320]}
mdsntvssfqvdcflwhvrkqvvdqelgdapfldrlrrdqkslrgrgstlglnieaathv
gkqivekilkees

Timeline for d1ns1b_:

• d1ns1b_ first appeared (with stable ids) in SCOP 1.55
  
• d1ns1b_ appears in SCOPe 2.07