SCOPe 2.03: Domain d2e18b_: 2e18 B:

Lineage for d2e18b_ (2e18 B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families)
   share similar mode of ligand (Adenosine group) binding
   can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group

5. Family c.26.2.0: automated matches [191320] (1 protein)
   not a true family

6. Protein automated matches [190116] (13 species)
   not a true protein

7. Species Pyrococcus horikoshii [TaxId:70601] [187637] (3 PDB entries)

8. Domain d2e18b_: 2e18 B: [163803]
   automated match to d1xnga1
   complexed with imd, zn

Details for d2e18b_

PDB Entry: 2e18, 2.1 Å

PDB Description: Crystal structure of project PH0182 from Pyrococcus horikoshii OT3

PDB Compounds: (B:) nh(3)-dependent nad(+) synthetase

SCOPe Domain Sequences for d2e18b_:

Sequence; same for both SEQRES and ATOM records:

>d2e18b_ c.26.2.0 (B:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
mrildydkvierilefirekgnngvvigisggvdsatvaylatkalgkekvlglimpyfe
nkdvedaklvaeklgigykvinikpivdsfvenlelnldrkglgnimsrtrmimlyahan
slgrivlgtsnrsefltgyftkwgdgasdyapiinlyktevweiakrigvperivkkkps
aglwegqtdedelgisynlldeilwrmidlkigkeeiakdlgiplslverveelikkseh
krrlpigpsfedlivg

Timeline for d2e18b_:

• d2e18b_ first appeared in SCOPe 2.01
  
• d2e18b_ appears in SCOPe 2.02
  
• d2e18b_ appears in SCOPe 2.04
  
• d2e18b_ appears in the current release, SCOPe 2.08