Lineage for d2e18b_ (2e18 B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1590099Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1590910Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) (S)
    share similar mode of ligand (Adenosine group) binding
    can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group
  5. 1591169Family c.26.2.0: automated matches [191320] (1 protein)
    not a true family
  6. 1591170Protein automated matches [190116] (16 species)
    not a true protein
  7. 1591227Species Pyrococcus horikoshii [TaxId:70601] [187637] (3 PDB entries)
  8. 1591231Domain d2e18b_: 2e18 B: [163803]
    automated match to d1xnga1
    complexed with imd, zn

Details for d2e18b_

PDB Entry: 2e18 (more details), 2.1 Å

PDB Description: Crystal structure of project PH0182 from Pyrococcus horikoshii OT3
PDB Compounds: (B:) nh(3)-dependent nad(+) synthetase

SCOPe Domain Sequences for d2e18b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e18b_ c.26.2.0 (B:) automated matches {Pyrococcus horikoshii [TaxId: 70601]}
mrildydkvierilefirekgnngvvigisggvdsatvaylatkalgkekvlglimpyfe
nkdvedaklvaeklgigykvinikpivdsfvenlelnldrkglgnimsrtrmimlyahan
slgrivlgtsnrsefltgyftkwgdgasdyapiinlyktevweiakrigvperivkkkps
aglwegqtdedelgisynlldeilwrmidlkigkeeiakdlgiplslverveelikkseh
krrlpigpsfedlivg

SCOPe Domain Coordinates for d2e18b_:

Click to download the PDB-style file with coordinates for d2e18b_.
(The format of our PDB-style files is described here.)

Timeline for d2e18b_: