Lineage for d2dyyi_ (2dyy I:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2201108Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2201109Superfamily d.79.1: YjgF-like [55298] (3 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2201110Family d.79.1.1: YjgF/L-PSP [55299] (12 proteins)
    some members possess an endoribonuclease activity inhibiting mRNA translation
  6. 2201194Protein automated matches [190254] (4 species)
    not a true protein
  7. 2201208Species Pyrococcus horikoshii [TaxId:53953] [187648] (1 PDB entry)
  8. 2201217Domain d2dyyi_: 2dyy I: [163751]
    automated match to d1x25a1

Details for d2dyyi_

PDB Entry: 2dyy (more details), 2.6 Å

PDB Description: Crystal structure of putative translation initiation inhibitor PH0854 from Pyrococcus horikoshii
PDB Compounds: (I:) UPF0076 protein PH0854

SCOPe Domain Sequences for d2dyyi_:

Sequence, based on SEQRES records: (download)

>d2dyyi_ d.79.1.1 (I:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
keviftenapkpigpysqaikagnflfiagqipidpktgeivkgdikdqtrqvlenikai
leaagyslndvikvtvylkdmndfakmnevyaeyfgeskparvavevsrlpkdvlieiea
iayke

Sequence, based on observed residues (ATOM records): (download)

>d2dyyi_ d.79.1.1 (I:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
keviftenapkpigpysqaikagnflfiagqipidpktgeivkgdikdqtrqvlenikai
leaagyslndvikvtvylkdvyaeyfgeskparvavevsrlpkdvlieieaiayke

SCOPe Domain Coordinates for d2dyyi_:

Click to download the PDB-style file with coordinates for d2dyyi_.
(The format of our PDB-style files is described here.)

Timeline for d2dyyi_: