Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily) consists of two non-similar domains Domain 1 has parallel sheet of 5 strands, order 32415 Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest |
Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) |
Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins) Pfam PF00590 |
Protein Diphthine synthase, DphB [102684] (3 species) diphthamide biosynthesis methyltransferase |
Species Pyrococcus horikoshii [TaxId:53953] [142779] (80 PDB entries) Uniprot O58456 1-265 |
Domain d2dv4a_: 2dv4 A: [163713] automated match to d1vcea1 complexed with cl, gol, mes, sah, so4; mutant |
PDB Entry: 2dv4 (more details), 2.2 Å
SCOPe Domain Sequences for d2dv4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dv4a_ c.90.1.1 (A:) Diphthine synthase, DphB {Pyrococcus horikoshii [TaxId: 53953]} mvlyfiglglyderditvkgleiakkcdyvfaefytslmagttlgriqkligkeirvlsr edveqnfenivlplakendvafltpgdplvatthaelrirakragvesyvihapsiysav gitglhiykfgksatvaypegnwfptsyydvikenaerglhtllfldikaekrmymtane amelllkvedmkkggvftddtlvvvlaragslnptiragyvkdliredfgdpphilivpg klhiveaeylveiagapreilrvnv
Timeline for d2dv4a_: