Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) |
Family c.1.4.0: automated matches [191310] (1 protein) not a true family |
Protein automated matches [190048] (31 species) not a true protein |
Species Aerococcus viridans [TaxId:1377] [187639] (8 PDB entries) |
Domain d2du2b_: 2du2 B: [163696] automated match to d1tb3a1 complexed with fmn |
PDB Entry: 2du2 (more details), 2.1 Å
SCOPe Domain Sequences for d2du2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2du2b_ c.1.4.0 (B:) automated matches {Aerococcus viridans [TaxId: 1377]} mnnndieynapseikyidvvntydleeeaskvvphggfnyiagasgdewtkrandrawkh kllyprlaqdveapdtsteilghkikapfimapiaahglahttkeagtaravsefgtims isaysgatfeeiseglnggprwfqiymakddqqnrdildeaksdgataiiltadstvsgn rdrdvknkfvypfgmpivqrylrgtaegmslnniygaskqkisprdieeiaghsglpvfv kgiqhpedadmaikrgasgiwvsnhgarqlyeapgsfdtlpaiaervnkrvpivfdsgvr rgehvakalasgadvvalgrpvlfglalggwqgaysvldyfqkdltrvmqltgsqnvedl kgldlfdnpygyey
Timeline for d2du2b_: