Lineage for d2dtxa_ (2dtx A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1580116Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1580117Protein automated matches [190069] (181 species)
    not a true protein
  7. 1581611Species Thermoplasma acidophilum [TaxId:2303] [187636] (6 PDB entries)
  8. 1581612Domain d2dtxa_: 2dtx A: [163693]
    automated match to d2d1ya1
    complexed with bma, so4

Details for d2dtxa_

PDB Entry: 2dtx (more details), 1.6 Å

PDB Description: structure of thermoplasma acidophilum aldohexose dehydrogenase (aldt) in complex with d-mannose
PDB Compounds: (A:) Glucose 1-dehydrogenase related protein

SCOPe Domain Sequences for d2dtxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dtxa_ c.2.1.0 (A:) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
gfsdlrdkvvivtgasmgigraiaerfvdegskvidlsihdpgeakydhiecdvtnpdqv
kasidhifkeygsisvlvnnagiesygkiesmsmgewrriidvnlfgyyyaskfaipymi
rsrdpsivnissvqasiitknasayvtskhavigltksialdyapllrcnavcpatidtp
lvrkaaelevgsdpmriekkisewghehpmqrigkpqevasavaflasreasfitgtcly
vdgglsirapistpe

SCOPe Domain Coordinates for d2dtxa_:

Click to download the PDB-style file with coordinates for d2dtxa_.
(The format of our PDB-style files is described here.)

Timeline for d2dtxa_: