Lineage for d1ef1a1 (1ef1 A:88-198)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 764491Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 764506Superfamily a.11.2: Second domain of FERM [47031] (1 family) (S)
  5. 764507Family a.11.2.1: Second domain of FERM [47032] (8 proteins)
  6. 764530Protein Moesin [47033] (1 species)
  7. 764531Species Human (Homo sapiens) [TaxId:9606] [47034] (3 PDB entries)
    Uniprot P26038 4-297
  8. 764532Domain d1ef1a1: 1ef1 A:88-198 [16368]
    Other proteins in same PDB: d1ef1a2, d1ef1a3, d1ef1b2, d1ef1b3, d1ef1c_, d1ef1d_

Details for d1ef1a1

PDB Entry: 1ef1 (more details), 1.9 Å

PDB Description: crystal structure of the moesin ferm domain/tail domain complex
PDB Compounds: (A:) moesin

SCOP Domain Sequences for d1ef1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ef1a1 a.11.2.1 (A:88-198) Moesin {Human (Homo sapiens) [TaxId: 9606]}
dvseeliqditqrlfflqvkegilnddiycppetavllasyavqskygdfnkevhksgyl
agdkllpqrvleqhklnkdqweeriqvwheehrgmlredavleylkiaqdl

SCOP Domain Coordinates for d1ef1a1:

Click to download the PDB-style file with coordinates for d1ef1a1.
(The format of our PDB-style files is described here.)

Timeline for d1ef1a1: