![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies) core: 3 helices; bundle, closed, left-handed twist; up-and-down |
![]() | Superfamily a.11.2: Second domain of FERM [47031] (1 family) ![]() |
![]() | Family a.11.2.1: Second domain of FERM [47032] (8 proteins) |
![]() | Protein Moesin [47033] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47034] (3 PDB entries) Uniprot P26038 4-297 |
![]() | Domain d1ef1a1: 1ef1 A:88-198 [16368] Other proteins in same PDB: d1ef1a2, d1ef1a3, d1ef1b2, d1ef1b3, d1ef1c_, d1ef1d_ |
PDB Entry: 1ef1 (more details), 1.9 Å
SCOP Domain Sequences for d1ef1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ef1a1 a.11.2.1 (A:88-198) Moesin {Human (Homo sapiens) [TaxId: 9606]} dvseeliqditqrlfflqvkegilnddiycppetavllasyavqskygdfnkevhksgyl agdkllpqrvleqhklnkdqweeriqvwheehrgmlredavleylkiaqdl
Timeline for d1ef1a1: