Lineage for d1ef1a3 (1ef1 A:4-87)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 853596Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 853597Superfamily d.15.1: Ubiquitin-like [54236] (8 families) (S)
  5. 853959Family d.15.1.4: First domain of FERM [54256] (6 proteins)
  6. 853982Protein Moesin [54257] (1 species)
  7. 853983Species Human (Homo sapiens) [TaxId:9606] [54258] (3 PDB entries)
    Uniprot P26038 4-297
  8. 853984Domain d1ef1a3: 1ef1 A:4-87 [37611]
    Other proteins in same PDB: d1ef1a1, d1ef1a2, d1ef1b1, d1ef1b2, d1ef1c_, d1ef1d_

Details for d1ef1a3

PDB Entry: 1ef1 (more details), 1.9 Å

PDB Description: crystal structure of the moesin ferm domain/tail domain complex
PDB Compounds: (A:) moesin

SCOP Domain Sequences for d1ef1a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ef1a3 d.15.1.4 (A:4-87) Moesin {Human (Homo sapiens) [TaxId: 9606]}
tisvrvttmdaelefaiqpnttgkqlfdqvvktiglrevwffglqyqdtkgfstwlklnk
kvtaqdvrkespllfkfrakfype

SCOP Domain Coordinates for d1ef1a3:

Click to download the PDB-style file with coordinates for d1ef1a3.
(The format of our PDB-style files is described here.)

Timeline for d1ef1a3: