Lineage for d2ds7a_ (2ds7 A:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1065411Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1065412Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1065868Family g.39.1.11: ClpX chaperone zinc binding domain [103608] (2 proteins)
  6. 1065873Protein automated matches [190269] (1 species)
    not a true protein
  7. 1065874Species Escherichia coli [TaxId:562] [187059] (4 PDB entries)
  8. 1065881Domain d2ds7a_: 2ds7 A: [163674]
    automated match to d1ovxa_
    complexed with zn

Details for d2ds7a_

PDB Entry: 2ds7 (more details), 2.5 Å

PDB Description: structure of the zbd in the hexagonal crystal form
PDB Compounds: (A:) ATP-dependent Clp protease ATP-binding subunit clpX

SCOPe Domain Sequences for d2ds7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ds7a_ g.39.1.11 (A:) automated matches {Escherichia coli [TaxId: 562]}
lycsfcgksqhevrkliagpsvyicdecvdlmndiireei

SCOPe Domain Coordinates for d2ds7a_:

Click to download the PDB-style file with coordinates for d2ds7a_.
(The format of our PDB-style files is described here.)

Timeline for d2ds7a_: