SCOPe 2.07: Domain d2dppb_: 2dpp B:

Lineage for d2dppb_ (2dpp B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families)

5. Family b.34.4.4: Nitrile hydratase beta chain [50101] (3 proteins)
   contains irregular array of helices in the N-terminal extension
   automatically mapped to Pfam PF02211

6. Protein automated matches [190606] (3 species)
   not a true protein

7. Species Bacillus sp. [TaxId:218609] [187627] (1 PDB entry)

8. Domain d2dppb_: 2dpp B: [163654]
   Other proteins in same PDB: d2dppa_
   automated match to d1v29b_
   complexed with co

Details for d2dppb_

PDB Entry: 2dpp, 2.52 Å

PDB Description: Crystal structure of thermostable Bacillus sp. RAPc8 nitrile hydratase

PDB Compounds: (B:) Nitrile hydratase beta subunit

SCOPe Domain Sequences for d2dppb_:

Sequence; same for both SEQRES and ATOM records:

>d2dppb_ b.34.4.4 (B:) automated matches {Bacillus sp. [TaxId: 218609]}
mngihdvggmdgfgkvmyvkeeediyfthdwerlafglvagcmaqglgmkafdefrigie
lmrpvdyltssyyghwiatvaynlvdtgvldekeldertevflkkpdtkiprredpalvk
lvekalydglsplreisasprfkvgeriktknihptghtrfpryardkygvidevygahv
fpddaahrkgenpqylyrvrfeaeelwgykqkdsvyidlwesymepv

Timeline for d2dppb_:

• d2dppb_ first appeared in SCOPe 2.01
  
• d2dppb_ appears in SCOPe 2.06
  
• d2dppb_ appears in the current release, SCOPe 2.08