SCOPe 2.01: Domain d2d8na_: 2d8n A:

Lineage for d2d8na_ (2d8n A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein automated matches [190064] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186813] (6 PDB entries)

8. Domain d2d8na_: 2d8n A: [163607]
   automated match to d1reca_

Details for d2d8na_

PDB Entry: 2d8n, 2.2 Å

PDB Description: Crystal structure of human recoverin at 2.2 A resolution

PDB Compounds: (A:) Recoverin

SCOPe Domain Sequences for d2d8na_:

Sequence; same for both SEQRES and ATOM records:

>d2d8na_ a.39.1.5 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgnsksgalskeileelqlntkfseeelcswyqsflkdcptgritqqqfqsiyakffpdt
dpkayaqhvfrsfdsnldgtldfkeyvialhmttagktnqklewafslydvdgngtiskn
evleivmaifkmitpedvkllpddentpekraekiwkyfgkndddkltekefiegtlank
eilrliqfepqkvkekm

Timeline for d2d8na_:

• d2d8na_ is new in SCOPe 2.01-stable
  
• d2d8na_ appears in SCOPe 2.02
  
• d2d8na_ appears in the current release, SCOPe 2.08