Lineage for d2pdea_ (2pde A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1482050Fold a.9: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47004] (1 superfamily)
    3 helices; bundle, closed, right-handed twist; up-and-down
  4. 1482051Superfamily a.9.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47005] (2 families) (S)
  5. 1482052Family a.9.1.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47006] (4 proteins)
  6. 1482061Protein E3/E1 binding domain of dihydrolipoyl acetyltransferase [47011] (1 species)
  7. 1482062Species Bacillus stearothermophilus [TaxId:1422] [47012] (5 PDB entries)
    Uniprot P11961 118-170
    Uniprot Q8VV74 128-169
  8. 1482069Domain d2pdea_: 2pde A: [16359]

Details for d2pdea_

PDB Entry: 2pde (more details)

PDB Description: the high resolution structure of the peripheral subunit-binding domain of dihydrolipoamide acetyltransferase from the pyruvate dehydrogenase multienzyme complex of bacillus stearothermophilus
PDB Compounds: (A:) dihydrolipoamide acetyltransferase

SCOPe Domain Sequences for d2pdea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pdea_ a.9.1.1 (A:) E3/E1 binding domain of dihydrolipoyl acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]}
viampsvrkyarekgvdirlvqgtgkngrvlkedidaflagga

SCOPe Domain Coordinates for d2pdea_:

Click to download the PDB-style file with coordinates for d2pdea_.
(The format of our PDB-style files is described here.)

Timeline for d2pdea_: