SCOPe 2.04: Domain d2d2mb_: 2d2m B:

Lineage for d2d2mb_ (2d2m B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.0: automated matches [191420] (1 protein)
   not a true family

6. Protein automated matches [190590] (15 species)
   not a true protein

7. Species Oligobrachia mashikoi [TaxId:55676] [187601] (4 PDB entries)

8. Domain d2d2mb_: 2d2m B: [163560]
   automated match to d1x9fb_
   complexed with hem, oxy

Details for d2d2mb_

PDB Entry: 2d2m, 2.85 Å

PDB Description: Structure of an extracellular giant hemoglobin of the gutless beard worm Oligobrachia mashikoi

PDB Compounds: (B:) Giant hemoglobin, A2(a5) globin chain

SCOPe Domain Sequences for d2d2mb_:

Sequence; same for both SEQRES and ATOM records:

>d2d2mb_ a.1.1.0 (B:) automated matches {Oligobrachia mashikoi [TaxId: 55676]}
dctslnrllvkrqwaeaygegtnrellgnriwedlfanmpdarglfsrvngndidssefq
ahslrvlggldmcvaslddvpvlnallarlnsqhdsrgipaagypafvasaisavratvg
arsfdndawnscmnqivsgisg

Timeline for d2d2mb_:

• d2d2mb_ first appeared in SCOPe 2.01
  
• d2d2mb_ appears in SCOPe 2.03
  
• d2d2mb_ appears in SCOPe 2.05
  
• d2d2mb_ appears in the current release, SCOPe 2.08