Lineage for d2d1xa_ (2d1x A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1120542Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1120633Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1120995Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 1120996Protein automated matches [190457] (5 species)
    not a true protein
  7. 1121018Species Human (Homo sapiens) [TaxId:9606] [187598] (12 PDB entries)
  8. 1121027Domain d2d1xa_: 2d1x A: [163553]
    automated match to d1jo8a_
    complexed with so4

Details for d2d1xa_

PDB Entry: 2d1x (more details), 1.9 Å

PDB Description: The crystal structure of the cortactin-SH3 domain and AMAP1-peptide complex
PDB Compounds: (A:) cortactin isoform a

SCOPe Domain Sequences for d2d1xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d1xa_ b.34.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ndlgitavalydyqaagddeisfdpddiitniemiddgwwrgvckgryglfpanyvelrq

SCOPe Domain Coordinates for d2d1xa_:

Click to download the PDB-style file with coordinates for d2d1xa_.
(The format of our PDB-style files is described here.)

Timeline for d2d1xa_: