Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.106: SCP-like [55717] (1 superfamily) alpha-beta(3)-(crossover)-beta-(alpha)-beta; 3 layers: a/b/a; antiparallel beta-sheet of 5 strands; order: 32145 |
Superfamily d.106.1: SCP-like [55718] (5 families) |
Family d.106.1.1: Sterol carrier protein, SCP [55719] (4 proteins) Pfam PF02036 |
Protein automated matches [190237] (3 species) not a true protein |
Species Thermus thermophilus [TaxId:274] [187580] (1 PDB entry) |
Domain d2cx7a_: 2cx7 A: [163489] automated match to d1wfra_ complexed with po4 |
PDB Entry: 2cx7 (more details), 1.75 Å
SCOPe Domain Sequences for d2cx7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cx7a_ d.106.1.1 (A:) automated matches {Thermus thermophilus [TaxId: 274]} elfteawaqaycrklneseayrkaastwegslalavrpdpkagfpkgvavvldlwhgacr gakavegeaeadfvieadlatwqevlegrleplsalmrgllelkkgtiaalapyaqaaqe lvkvareva
Timeline for d2cx7a_: