Lineage for d2cx5a_ (2cx5 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2972065Fold d.116: YbaK/ProRS associated domain [55825] (1 superfamily)
    core: alpha-beta-alpha-beta(2)-(alpha-beta)2-alpha-beta(2)-alpha-beta; 3 layers; bifurcated mixed sheet
  4. 2972066Superfamily d.116.1: YbaK/ProRS associated domain [55826] (2 families) (S)
  5. 2972087Family d.116.1.0: automated matches [191417] (1 protein)
    not a true family
  6. 2972088Protein automated matches [190578] (4 species)
    not a true protein
  7. 2972102Species Thermus thermophilus [TaxId:274] [187579] (2 PDB entries)
  8. 2972104Domain d2cx5a_: 2cx5 A: [163485]
    automated match to d1wdva_

Details for d2cx5a_

PDB Entry: 2cx5 (more details), 1.9 Å

PDB Description: Crystal structure of a putative trans-editing enzyme for prolyl tRNA synthetase
PDB Compounds: (A:) a putative trans-editing enzyme

SCOPe Domain Sequences for d2cx5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cx5a_ d.116.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 274]}
slspsarrvqgaletrgfghlkvvelpastrtakeaaqavgaevgqivkslvfvgekgay
lflvsgknrldlgkatrlvggplrqatpeevreltgfaiggvppvghntplpayldedll
gypevwaaggtpralfratpkellaltgaqvadlkeg

SCOPe Domain Coordinates for d2cx5a_:

Click to download the PDB-style file with coordinates for d2cx5a_.
(The format of our PDB-style files is described here.)

Timeline for d2cx5a_: