Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.116: YbaK/ProRS associated domain [55825] (1 superfamily) core: alpha-beta-alpha-beta(2)-(alpha-beta)2-alpha-beta(2)-alpha-beta; 3 layers; bifurcated mixed sheet |
Superfamily d.116.1: YbaK/ProRS associated domain [55826] (2 families) |
Family d.116.1.0: automated matches [191417] (1 protein) not a true family |
Protein automated matches [190578] (4 species) not a true protein |
Species Thermus thermophilus [TaxId:274] [187579] (2 PDB entries) |
Domain d2cx5a_: 2cx5 A: [163485] automated match to d1wdva_ |
PDB Entry: 2cx5 (more details), 1.9 Å
SCOPe Domain Sequences for d2cx5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cx5a_ d.116.1.0 (A:) automated matches {Thermus thermophilus [TaxId: 274]} slspsarrvqgaletrgfghlkvvelpastrtakeaaqavgaevgqivkslvfvgekgay lflvsgknrldlgkatrlvggplrqatpeevreltgfaiggvppvghntplpayldedll gypevwaaggtpralfratpkellaltgaqvadlkeg
Timeline for d2cx5a_: