SCOPe 2.04: Domain d2ck1a_: 2ck1 A:

Lineage for d2ck1a_ (2ck1 A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.62: Cyclophilin-like [50890] (1 superfamily)
   barrel, closed; n=8, S=10; complex topology

4. Superfamily b.62.1: Cyclophilin-like [50891] (5 families)

5. Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
   automatically mapped to Pfam PF00160

6. Protein automated matches [190077] (17 species)
   not a true protein

7. Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [187342] (2 PDB entries)

8. Domain d2ck1a_: 2ck1 A: [163425]
   automated match to d2bitx1
   complexed with act

Details for d2ck1a_

PDB Entry: 2ck1, 1.8 Å

PDB Description: the structure of oxidised cyclophilin a from s. mansoni

PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase e

SCOPe Domain Sequences for d2ck1a_:

Sequence; same for both SEQRES and ATOM records:

>d2ck1a_ b.62.1.1 (A:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
nlprvffdirigngdagrivmelrsdivprtaenfralctgergfgyhnccfhrvipqfm
cqggdfvkgdgtggksiygrkfddenfqlrhegfgvlsmansgpntngsqfficttkcdw
ldgkhvvfgrvvdgqnvvkkmesvgsksgkvkepviisrcgeli

Timeline for d2ck1a_:

• d2ck1a_ first appeared in SCOPe 2.01
  
• d2ck1a_ appears in SCOPe 2.03
  
• d2ck1a_ appears in SCOPe 2.05
  
• d2ck1a_ appears in the current release, SCOPe 2.08