Lineage for d2ck1a_ (2ck1 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1553283Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 1553284Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 1553285Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 1553529Protein automated matches [190077] (17 species)
    not a true protein
  7. 1553536Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [187342] (2 PDB entries)
  8. 1553538Domain d2ck1a_: 2ck1 A: [163425]
    automated match to d2bitx1
    complexed with act

Details for d2ck1a_

PDB Entry: 2ck1 (more details), 1.8 Å

PDB Description: the structure of oxidised cyclophilin a from s. mansoni
PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase e

SCOPe Domain Sequences for d2ck1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ck1a_ b.62.1.1 (A:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
nlprvffdirigngdagrivmelrsdivprtaenfralctgergfgyhnccfhrvipqfm
cqggdfvkgdgtggksiygrkfddenfqlrhegfgvlsmansgpntngsqfficttkcdw
ldgkhvvfgrvvdgqnvvkkmesvgsksgkvkepviisrcgeli

SCOPe Domain Coordinates for d2ck1a_:

Click to download the PDB-style file with coordinates for d2ck1a_.
(The format of our PDB-style files is described here.)

Timeline for d2ck1a_: