SCOPe 2.06: Domain d2ccmb_: 2ccm B:

Lineage for d2ccmb_ (2ccm B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.0: automated matches [191396] (1 protein)
   not a true family

6. Protein automated matches [190513] (30 species)
   not a true protein

7. Species Loligo pealeii [TaxId:6621] [187536] (1 PDB entry)

8. Domain d2ccmb_: 2ccm B: [163373]
   automated match to d2sasa_
   complexed with ca

Details for d2ccmb_

PDB Entry: 2ccm, 1.8 Å

PDB Description: x-ray structure of calexcitin from loligo pealeii at 1.8a

PDB Compounds: (B:) calexcitin

SCOPe Domain Sequences for d2ccmb_:

Sequence; same for both SEQRES and ATOM records:

>d2ccmb_ a.39.1.0 (B:) automated matches {Loligo pealeii [TaxId: 6621]}
aahqlsdfqrnkilrvfntfydcnhdgviewddfelaikkicnlhswptdgkkhnearat
lkliwdglrkyadenedeqvtkeewlkmwaecvksvekgeslpewltkymnfmfdvndts
gdniidkheystvymsygipksdcdaafdtlsdggktmvtreifarlwteyfvsndrgak
gnhlfgtlkl

Timeline for d2ccmb_:

• d2ccmb_ first appeared in SCOPe 2.01
  
• d2ccmb_ appears in SCOPe 2.05
  
• d2ccmb_ appears in SCOPe 2.07
  
• d2ccmb_ appears in the current release, SCOPe 2.08