Class a: All alpha proteins [46456] (289 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.0: automated matches [191396] (1 protein) not a true family |
Protein automated matches [190513] (30 species) not a true protein |
Species Loligo pealeii [TaxId:6621] [187536] (1 PDB entry) |
Domain d2ccmb_: 2ccm B: [163373] automated match to d2sasa_ complexed with ca |
PDB Entry: 2ccm (more details), 1.8 Å
SCOPe Domain Sequences for d2ccmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ccmb_ a.39.1.0 (B:) automated matches {Loligo pealeii [TaxId: 6621]} aahqlsdfqrnkilrvfntfydcnhdgviewddfelaikkicnlhswptdgkkhnearat lkliwdglrkyadenedeqvtkeewlkmwaecvksvekgeslpewltkymnfmfdvndts gdniidkheystvymsygipksdcdaafdtlsdggktmvtreifarlwteyfvsndrgak gnhlfgtlkl
Timeline for d2ccmb_: