Lineage for d2c91f_ (2c91 F:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2437818Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2437819Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 2438218Protein automated matches [190169] (7 species)
    not a true protein
  7. 2438301Species Mouse (Mus musculus) [TaxId:10090] [187524] (12 PDB entries)
  8. 2438323Domain d2c91f_: 2c91 F: [163329]
    automated match to d1gvea_
    complexed with gol, mes, nap, po4, tla

Details for d2c91f_

PDB Entry: 2c91 (more details), 2.3 Å

PDB Description: mouse succinic semialdehyde reductase, akr7a5
PDB Compounds: (F:) aflatoxin b1 aldehyde reductase member 2

SCOPe Domain Sequences for d2c91f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c91f_ c.1.7.1 (F:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lrpatvlgtmemgrrmdasasaasvraflerghseldtafmycdgqsenilgglglglgs
gdctvkiatkanpwegkslkpdsirsqletslkrlqcprvdlfylhapdhstpveetlca
chqlhqegkfvelglsnyaswevaeictlcksngwilptvyqgmynattrqveaellpcl
rhfglrfyaynplagglltgkykyedkdgkqpvgrffgnnwaetyrnrfwkehhfeaial
vekalqttygtnaprmtsaalrwmyhhsqlqgtrgdavilgmssleqleqnlaateegpl
epavveafdqawnmvahecpnyfr

SCOPe Domain Coordinates for d2c91f_:

Click to download the PDB-style file with coordinates for d2c91f_.
(The format of our PDB-style files is described here.)

Timeline for d2c91f_: