Lineage for d1g73a_ (1g73 A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 908235Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 908354Superfamily a.7.4: Smac/diablo [46984] (1 family) (S)
  5. 908355Family a.7.4.1: Smac/diablo [46985] (1 protein)
    this is a repeat family; one repeat unit is 1few A: found in domain
  6. 908356Protein Smac/diablo [46986] (1 species)
  7. 908357Species Human (Homo sapiens) [TaxId:9606] [46987] (2 PDB entries)
  8. 908358Domain d1g73a_: 1g73 A: [16332]
    Other proteins in same PDB: d1g73c_, d1g73d_
    bound to xiap-bir3 domain
    complexed with zn

Details for d1g73a_

PDB Entry: 1g73 (more details), 2 Å

PDB Description: crystal structure of smac bound to xiap-bir3 domain
PDB Compounds: (A:) second mitochondria-derived activator of caspases

SCOPe Domain Sequences for d1g73a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g73a_ a.7.4.1 (A:) Smac/diablo {Human (Homo sapiens) [TaxId: 9606]}
avpiaqksephslssealmrravslvtdststdlsqttyalieaiteytkavytltslyr
qytsllgkmnseeedevwqviigaraemtskhqeylklettwmtavglsemaaeaayqtg
adqasitarnhiqlvklqveevhqlsrkaetklaeaq

SCOPe Domain Coordinates for d1g73a_:

Click to download the PDB-style file with coordinates for d1g73a_.
(The format of our PDB-style files is described here.)

Timeline for d1g73a_: