SCOPe 2.01: Domain d2c8hb_: 2c8h B:

Lineage for d2c8hb_ (2c8h B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)

6. Protein automated matches [190133] (3 species)
   not a true protein

7. Species Clostridium botulinum [TaxId:1491] [187018] (8 PDB entries)

8. Domain d2c8hb_: 2c8h B: [163319]
   automated match to d1g24a_
   complexed with nad, so4; mutant

Details for d2c8hb_

PDB Entry: 2c8h, 1.65 Å

PDB Description: structure of the pn loop q182a mutant c3bot1 exoenzyme (nad-bound state, crystal form i)

PDB Compounds: (B:) Mono-ADP-ribosyltransferase C3

SCOPe Domain Sequences for d2c8hb_:

Sequence; same for both SEQRES and ATOM records:

>d2c8hb_ d.166.1.1 (B:) automated matches {Clostridium botulinum [TaxId: 1491]}
tyqeftnidqakawgnaqykkyglsksekeaivsytksaseingklrqnkgvingfpsnl
ikqvelldksfnkmktpenimlfrgddpaylgtefqntllnsngtinktafekakakfln
kdrleygyistslmnvsafagrpiitkfkvakgskagyidpisafagqlemllprhstyh
iddmrlssdgkqiiitatmmgtain

Timeline for d2c8hb_:

• d2c8hb_ is new in SCOPe 2.01-stable
  
• d2c8hb_ appears in SCOPe 2.02
  
• d2c8hb_ appears in the current release, SCOPe 2.08